Anti WDR72 pAb (ATL-HPA059819)

Atlas Antibodies

Catalog No: ATL-HPA059819-25

• 
• 

Product Description

Protein Description: WD repeat domain 72
Gene Name: WDR72
Alternative Gene Name: FLJ38736
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044976: 71%, ENSRNOG00000013429: 25%
Entrez Gene ID: 256764
Uniprot ID: Q3MJ13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LISCWRDQSVQVTEAIQAVLLAEVQQHMKSLGKIPVNSQPVSMAENGNCEMKQMLPKLEWTEELELQCVRNTLPLQTPVSPVKHDSNSNSANFQDV
• Gene Sequence: LISCWRDQSVQVTEAIQAVLLAEVQQHMKSLGKIPVNSQPVSMAENGNCEMKQMLPKLEWTEELELQCVRNTLPLQTPVSPVKHDSNSNSANFQDV
• Gene ID - Mouse: ENSMUSG00000044976
• Gene ID - Rat: ENSRNOG00000013429
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.