Description
Product Description
Protein Description: WD repeat domain 72
Gene Name: WDR72
Alternative Gene Name: FLJ38736
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044976: 71%, ENSRNOG00000013429: 25%
Entrez Gene ID: 256764
Uniprot ID: Q3MJ13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WDR72
Alternative Gene Name: FLJ38736
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044976: 71%, ENSRNOG00000013429: 25%
Entrez Gene ID: 256764
Uniprot ID: Q3MJ13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LISCWRDQSVQVTEAIQAVLLAEVQQHMKSLGKIPVNSQPVSMAENGNCEMKQMLPKLEWTEELELQCVRNTLPLQTPVSPVKHDSNSNSANFQDV |
Gene Sequence | LISCWRDQSVQVTEAIQAVLLAEVQQHMKSLGKIPVNSQPVSMAENGNCEMKQMLPKLEWTEELELQCVRNTLPLQTPVSPVKHDSNSNSANFQDV |
Gene ID - Mouse | ENSMUSG00000044976 |
Gene ID - Rat | ENSRNOG00000013429 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti WDR72 pAb (ATL-HPA059819) | |
Datasheet | Anti WDR72 pAb (ATL-HPA059819) Datasheet (External Link) |
Vendor Page | Anti WDR72 pAb (ATL-HPA059819) at Atlas Antibodies |
Documents & Links for Anti WDR72 pAb (ATL-HPA059819) | |
Datasheet | Anti WDR72 pAb (ATL-HPA059819) Datasheet (External Link) |
Vendor Page | Anti WDR72 pAb (ATL-HPA059819) |