Protein Description: WD repeat domain 60
Gene Name: WDR60
Alternative Gene Name: FAP163, FLJ10300
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042050: 82%, ENSRNOG00000004520: 82%
Entrez Gene ID: 55112
Uniprot ID: Q8WVS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WDR60
Alternative Gene Name: FAP163, FLJ10300
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042050: 82%, ENSRNOG00000004520: 82%
Entrez Gene ID: 55112
Uniprot ID: Q8WVS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DIQTEEIETREVWTQHPGESTVVSGGSEQRDTSDAVVMPKIDTPRLCSFLRAACQVMAVLLEEDRLAAEPSWNLRAQDRALYFSDSSSQLNTSLPFLQNRKVSSLHTSRVQRQMVVSVH |
| Documents & Links for Anti WDR60 pAb (ATL-HPA020607) | |
| Datasheet | Anti WDR60 pAb (ATL-HPA020607) Datasheet (External Link) |
| Vendor Page | Anti WDR60 pAb (ATL-HPA020607) at Atlas |
| Documents & Links for Anti WDR60 pAb (ATL-HPA020607) | |
| Datasheet | Anti WDR60 pAb (ATL-HPA020607) Datasheet (External Link) |
| Vendor Page | Anti WDR60 pAb (ATL-HPA020607) |
| Citations for Anti WDR60 pAb (ATL-HPA020607) – 2 Found |
| Asante, David; Stevenson, Nicola L; Stephens, David J. Subunit composition of the human cytoplasmic dynein-2 complex. Journal Of Cell Science. 2014;127(Pt 21):4774-87. PubMed |
| Li, Cui; Zheng, Yu; Zheng, Yufang; Xu, Zhiheng. SRPS associated protein WDR60 regulates the multipolar-to-bipolar transition of migrating neurons during cortical development. Cell Death & Disease. 2021;12(1):75. PubMed |