Description
Product Description
Protein Description: WD repeat domain 44
Gene Name: WDR44
Alternative Gene Name: DKFZp686L20145, RAB11BP, RPH11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036769: 100%, ENSRNOG00000029068: 100%
Entrez Gene ID: 54521
Uniprot ID: Q5JSH3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WDR44
Alternative Gene Name: DKFZp686L20145, RAB11BP, RPH11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036769: 100%, ENSRNOG00000029068: 100%
Entrez Gene ID: 54521
Uniprot ID: Q5JSH3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VIGTYDGRCIFYDTEHLKYHTQIHVRSTRGRNKVGRKITGIEPLPGENKILVTSNDSRIRLYDLRDLSLSMKYKG |
Gene Sequence | VIGTYDGRCIFYDTEHLKYHTQIHVRSTRGRNKVGRKITGIEPLPGENKILVTSNDSRIRLYDLRDLSLSMKYKG |
Gene ID - Mouse | ENSMUSG00000036769 |
Gene ID - Rat | ENSRNOG00000029068 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti WDR44 pAb (ATL-HPA046719) | |
Datasheet | Anti WDR44 pAb (ATL-HPA046719) Datasheet (External Link) |
Vendor Page | Anti WDR44 pAb (ATL-HPA046719) at Atlas Antibodies |
Documents & Links for Anti WDR44 pAb (ATL-HPA046719) | |
Datasheet | Anti WDR44 pAb (ATL-HPA046719) Datasheet (External Link) |
Vendor Page | Anti WDR44 pAb (ATL-HPA046719) |