Protein Description: WD repeat domain 1
Gene Name: WDR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005103: 90%, ENSRNOG00000028498: 92%
Entrez Gene ID: 9948
Uniprot ID: O75083
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WDR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005103: 90%, ENSRNOG00000028498: 92%
Entrez Gene ID: 9948
Uniprot ID: O75083
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGT |
Documents & Links for Anti WDR1 pAb (ATL-HPA070293) | |
Datasheet | Anti WDR1 pAb (ATL-HPA070293) Datasheet (External Link) |
Vendor Page | Anti WDR1 pAb (ATL-HPA070293) at Atlas |
Documents & Links for Anti WDR1 pAb (ATL-HPA070293) | |
Datasheet | Anti WDR1 pAb (ATL-HPA070293) Datasheet (External Link) |
Vendor Page | Anti WDR1 pAb (ATL-HPA070293) |