Polyclonal Antibody against Human WDFY1, Gene description: WD repeat and FYVE domain containing 1, Alternative Gene Names: FENS-1, KIAA1435, WDF1, ZFYVE17, Validated applications: ICC, Uniprot ID: Q8IWB7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VRVCDSCYDSIKDEDRTSLATFHEGKHNISHMSMDIARGLMVTCGTDRIVKI |
Gene ID - Mouse | ENSMUSG00000073643 |
Gene ID - Rat | ENSMUSG00000073643 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti-WDFY1 pAb (ATL-HPA079597) | |
Vendor Page | Anti-WDFY1 pAb (ATL-HPA079597) at Atlas |
Documents & Links for Anti-WDFY1 pAb (ATL-HPA079597) | |
Vendor Page | Anti-WDFY1 pAb (ATL-HPA079597) |