Anti-WDFY1 pAb (ATL-HPA079597)

Catalog No:
ATL-HPA079597-100
$596.00
Polyclonal Antibody against Human WDFY1, Gene description: WD repeat and FYVE domain containing 1, Alternative Gene Names: FENS-1, KIAA1435, WDF1, ZFYVE17, Validated applications: ICC, Uniprot ID: Q8IWB7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence VRVCDSCYDSIKDEDRTSLATFHEGKHNISHMSMDIARGLMVTCGTDRIVKI
Gene ID - Mouse ENSMUSG00000073643
Gene ID - Rat ENSMUSG00000073643
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti-WDFY1 pAb (ATL-HPA079597)
Vendor Page Anti-WDFY1 pAb (ATL-HPA079597) at Atlas

Documents & Links for Anti-WDFY1 pAb (ATL-HPA079597)
Vendor Page Anti-WDFY1 pAb (ATL-HPA079597)