Protein Description: WW domain binding protein 2
Gene Name: WBP2
Alternative Gene Name: WBP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034341: 95%, ENSRNOG00000007971: 93%
Entrez Gene ID: 23558
Uniprot ID: Q969T9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WBP2
Alternative Gene Name: WBP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034341: 95%, ENSRNOG00000007971: 93%
Entrez Gene ID: 23558
Uniprot ID: Q969T9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PYPGPMEPPVSGPDVPSTPAAEAKAAEAAASAYYNPGNPHNVYMPTSQPPPPPYYP |
Documents & Links for Anti WBP2 pAb (ATL-HPA068819) | |
Datasheet | Anti WBP2 pAb (ATL-HPA068819) Datasheet (External Link) |
Vendor Page | Anti WBP2 pAb (ATL-HPA068819) at Atlas |
Documents & Links for Anti WBP2 pAb (ATL-HPA068819) | |
Datasheet | Anti WBP2 pAb (ATL-HPA068819) Datasheet (External Link) |
Vendor Page | Anti WBP2 pAb (ATL-HPA068819) |