Anti WBP2 pAb (ATL-HPA068819)

Atlas Antibodies

Catalog No: ATL-HPA068819-25

• 

Product Description

Protein Description: WW domain binding protein 2
Gene Name: WBP2
Alternative Gene Name: WBP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034341: 95%, ENSRNOG00000007971: 93%
Entrez Gene ID: 23558
Uniprot ID: Q969T9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PYPGPMEPPVSGPDVPSTPAAEAKAAEAAASAYYNPGNPHNVYMPTSQPPPPPYYP
• Gene Sequence: PYPGPMEPPVSGPDVPSTPAAEAKAAEAAASAYYNPGNPHNVYMPTSQPPPPPYYP
• Gene ID - Mouse: ENSMUSG00000034341
• Gene ID - Rat: ENSRNOG00000007971
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.