Protein Description: WW domain binding protein 2
Gene Name: WBP2
Alternative Gene Name: WBP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034341: 100%, ENSRNOG00000007971: 97%
Entrez Gene ID: 23558
Uniprot ID: Q969T9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WBP2
Alternative Gene Name: WBP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034341: 100%, ENSRNOG00000007971: 97%
Entrez Gene ID: 23558
Uniprot ID: Q969T9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFG |
| Documents & Links for Anti WBP2 pAb (ATL-HPA065682) | |
| Datasheet | Anti WBP2 pAb (ATL-HPA065682) Datasheet (External Link) |
| Vendor Page | Anti WBP2 pAb (ATL-HPA065682) at Atlas |
| Documents & Links for Anti WBP2 pAb (ATL-HPA065682) | |
| Datasheet | Anti WBP2 pAb (ATL-HPA065682) Datasheet (External Link) |
| Vendor Page | Anti WBP2 pAb (ATL-HPA065682) |