Description
Product Description
Protein Description: WW domain binding protein 1
Gene Name: WBP1
Alternative Gene Name: WBP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030035: 75%, ENSRNOG00000061902: 73%
Entrez Gene ID: 23559
Uniprot ID: Q96G27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WBP1
Alternative Gene Name: WBP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030035: 75%, ENSRNOG00000061902: 73%
Entrez Gene ID: 23559
Uniprot ID: Q96G27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEG |
| Gene Sequence | DSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEG |
| Gene ID - Mouse | ENSMUSG00000030035 |
| Gene ID - Rat | ENSRNOG00000061902 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti WBP1 pAb (ATL-HPA057067) | |
| Datasheet | Anti WBP1 pAb (ATL-HPA057067) Datasheet (External Link) |
| Vendor Page | Anti WBP1 pAb (ATL-HPA057067) at Atlas Antibodies |
| Documents & Links for Anti WBP1 pAb (ATL-HPA057067) | |
| Datasheet | Anti WBP1 pAb (ATL-HPA057067) Datasheet (External Link) |
| Vendor Page | Anti WBP1 pAb (ATL-HPA057067) |