Protein Description: WAS protein family member 3
Gene Name: WASF3
Alternative Gene Name: KIAA0900, SCAR3, WAVE3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029636: 86%, ENSRNOG00000048898: 86%
Entrez Gene ID: 10810
Uniprot ID: Q9UPY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WASF3
Alternative Gene Name: KIAA0900, SCAR3, WAVE3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029636: 86%, ENSRNOG00000048898: 86%
Entrez Gene ID: 10810
Uniprot ID: Q9UPY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QEWNMMAYDKELRPDNRLSQSVYHGASSEGSLSPDTRSHASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNRPQ |
| Documents & Links for Anti WASF3 pAb (ATL-HPA066228) | |
| Datasheet | Anti WASF3 pAb (ATL-HPA066228) Datasheet (External Link) |
| Vendor Page | Anti WASF3 pAb (ATL-HPA066228) at Atlas |
| Documents & Links for Anti WASF3 pAb (ATL-HPA066228) | |
| Datasheet | Anti WASF3 pAb (ATL-HPA066228) Datasheet (External Link) |
| Vendor Page | Anti WASF3 pAb (ATL-HPA066228) |