Protein Description: tryptophanyl tRNA synthetase 2, mitochondrial
Gene Name: WARS2
Alternative Gene Name: TrpRS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004233: 90%, ENSRNOG00000019508: 88%
Entrez Gene ID: 10352
Uniprot ID: Q9UGM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WARS2
Alternative Gene Name: TrpRS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004233: 90%, ENSRNOG00000019508: 88%
Entrez Gene ID: 10352
Uniprot ID: Q9UGM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MELVQDLAQGFNKKYGEFFPVPESILTSMKKVKSLRDPSAKMSKSDPDKLATVRITDSPEEIVQKFRKAVTDFTSEVTYDPA |
| Documents & Links for Anti WARS2 pAb (ATL-HPA069692 w/enhanced validation) | |
| Datasheet | Anti WARS2 pAb (ATL-HPA069692 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti WARS2 pAb (ATL-HPA069692 w/enhanced validation) at Atlas |
| Documents & Links for Anti WARS2 pAb (ATL-HPA069692 w/enhanced validation) | |
| Datasheet | Anti WARS2 pAb (ATL-HPA069692 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti WARS2 pAb (ATL-HPA069692 w/enhanced validation) |