Protein Description: WAPL cohesin release factor
Gene Name: WAPL
Alternative Gene Name: FOE, KIAA0261, WAPAL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041408: 81%, ENSRNOG00000052513: 78%
Entrez Gene ID: 23063
Uniprot ID: Q7Z5K2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WAPL
Alternative Gene Name: FOE, KIAA0261, WAPAL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041408: 81%, ENSRNOG00000052513: 78%
Entrez Gene ID: 23063
Uniprot ID: Q7Z5K2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EEHEKNSHHIHKNADDSTKKPNAETTVASEIKETNDTWNSQFGKRPESPSEISPIKGSVRTGLFEWDNDFEDIRSEDCILSLDSDPLLEMKDD |
| Documents & Links for Anti WAPL pAb (ATL-HPA066141) | |
| Datasheet | Anti WAPL pAb (ATL-HPA066141) Datasheet (External Link) |
| Vendor Page | Anti WAPL pAb (ATL-HPA066141) at Atlas |
| Documents & Links for Anti WAPL pAb (ATL-HPA066141) | |
| Datasheet | Anti WAPL pAb (ATL-HPA066141) Datasheet (External Link) |
| Vendor Page | Anti WAPL pAb (ATL-HPA066141) |