Anti VWF pAb (ATL-HPA002082)

Atlas Antibodies

Catalog No: ATL-HPA002082-25

• 
• 

Product Description

Protein Description: von Willebrand factor
Gene Name: VWF
Alternative Gene Name: F8VWF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001930: 82%, ENSRNOG00000019689: 78%
Entrez Gene ID: 7450
Uniprot ID: P04275
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RITLLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPPPTLPPDMAQVTVGPGLLGVSTLGPKRNSMVLDVAFVL
• Gene Sequence: RITLLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPPPTLPPDMAQVTVGPGLLGVSTLGPKRNSMVLDVAFVL
• Gene ID - Mouse: ENSMUSG00000001930
• Gene ID - Rat: ENSRNOG00000019689
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti VWF pAb (ATL-HPA002082) – 2 Found

Chakraborty, Goutam; Kumar, Santosh; Mishra, Rosalin; Patil, Tushar V; Kundu, Gopal C. Semaphorin 3A suppresses tumor growth and metastasis in mice melanoma model. Plos One. 7(3):e33633. 

Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038.