Protein Description: von Willebrand factor A domain containing 5B1
Gene Name: VWA5B1
Alternative Gene Name: FLJ32784
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028753: 62%, ENSRNOG00000016553: 57%
Entrez Gene ID: 127731
Uniprot ID: Q5TIE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: VWA5B1
Alternative Gene Name: FLJ32784
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028753: 62%, ENSRNOG00000016553: 57%
Entrez Gene ID: 127731
Uniprot ID: Q5TIE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | CNIISKYTAFVPVDVSKSRYLPTVVEYPNSGAALRMLGSRALAQQWRGTSSGFGRPQTMLGEDSAPGN |
| Documents & Links for Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation) | |
| Datasheet | Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation) at Atlas |
| Documents & Links for Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation) | |
| Datasheet | Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti VWA5B1 pAb (ATL-HPA064829 w/enhanced validation) |