Anti VSIG10L pAb (ATL-HPA066745)

Catalog No:
ATL-HPA066745-25
$401.00
Protein Description: V-set and immunoglobulin domain containing 10 like
Gene Name: VSIG10L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070604: 57%, ENSRNOG00000023411: 64%
Entrez Gene ID: 147645
Uniprot ID: Q86VR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence PSFTVKTPASNISTQVSHTKLSVEAPDSKFSPDDMDLKLSAQSPESKFSAETHSAASFPQQVGGPLAVLVGTTIRLPLVPIPNP

Documents & Links for Anti VSIG10L pAb (ATL-HPA066745)
Datasheet Anti VSIG10L pAb (ATL-HPA066745) Datasheet (External Link)
Vendor Page Anti VSIG10L pAb (ATL-HPA066745) at Atlas

Documents & Links for Anti VSIG10L pAb (ATL-HPA066745)
Datasheet Anti VSIG10L pAb (ATL-HPA066745) Datasheet (External Link)
Vendor Page Anti VSIG10L pAb (ATL-HPA066745)