Protein Description: V-set and immunoglobulin domain containing 10 like
Gene Name: VSIG10L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070604: 57%, ENSRNOG00000023411: 64%
Entrez Gene ID: 147645
Uniprot ID: Q86VR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: VSIG10L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070604: 57%, ENSRNOG00000023411: 64%
Entrez Gene ID: 147645
Uniprot ID: Q86VR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PSFTVKTPASNISTQVSHTKLSVEAPDSKFSPDDMDLKLSAQSPESKFSAETHSAASFPQQVGGPLAVLVGTTIRLPLVPIPNP |
Documents & Links for Anti VSIG10L pAb (ATL-HPA066745) | |
Datasheet | Anti VSIG10L pAb (ATL-HPA066745) Datasheet (External Link) |
Vendor Page | Anti VSIG10L pAb (ATL-HPA066745) at Atlas |
Documents & Links for Anti VSIG10L pAb (ATL-HPA066745) | |
Datasheet | Anti VSIG10L pAb (ATL-HPA066745) Datasheet (External Link) |
Vendor Page | Anti VSIG10L pAb (ATL-HPA066745) |