Anti VSIG10 pAb (ATL-HPA062022)

Atlas Antibodies

Catalog No: ATL-HPA062022-25

• 

Product Description

Protein Description: V-set and immunoglobulin domain containing 10
Gene Name: VSIG10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066894: 72%, ENSRNOG00000022698: 74%
Entrez Gene ID: 54621
Uniprot ID: Q8N0Z9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTCQVSGAYPPAKILWLRNLTQPEVIIQPSSRHLITQDGQNSTLTIHNCSQDLDEGYYICRADSPVGVREMEIWLSVK
• Gene Sequence: LTCQVSGAYPPAKILWLRNLTQPEVIIQPSSRHLITQDGQNSTLTIHNCSQDLDEGYYICRADSPVGVREMEIWLSVK
• Gene ID - Mouse: ENSMUSG00000066894
• Gene ID - Rat: ENSRNOG00000022698
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.