Protein Description: vacuolar protein sorting 54 homolog (S. cerevisiae)
Gene Name: VPS54
Alternative Gene Name: HCC8, PPP1R164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020128: 97%, ENSRNOG00000007125: 98%
Entrez Gene ID: 51542
Uniprot ID: Q9P1Q0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: VPS54
Alternative Gene Name: HCC8, PPP1R164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020128: 97%, ENSRNOG00000007125: 98%
Entrez Gene ID: 51542
Uniprot ID: Q9P1Q0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EKIHERCKNICPPKDTFERTLLHTHDKSRTDLEQVPKIFMKPDFALDDSLTFNSVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVN |
| Documents & Links for Anti VPS54 pAb (ATL-HPA067981) | |
| Datasheet | Anti VPS54 pAb (ATL-HPA067981) Datasheet (External Link) |
| Vendor Page | Anti VPS54 pAb (ATL-HPA067981) at Atlas |
| Documents & Links for Anti VPS54 pAb (ATL-HPA067981) | |
| Datasheet | Anti VPS54 pAb (ATL-HPA067981) Datasheet (External Link) |
| Vendor Page | Anti VPS54 pAb (ATL-HPA067981) |