Anti VPS54 pAb (ATL-HPA067981)

Atlas Antibodies

Catalog No: ATL-HPA067981-25

• 

Product Description

Protein Description: vacuolar protein sorting 54 homolog (S. cerevisiae)
Gene Name: VPS54
Alternative Gene Name: HCC8, PPP1R164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020128: 97%, ENSRNOG00000007125: 98%
Entrez Gene ID: 51542
Uniprot ID: Q9P1Q0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKIHERCKNICPPKDTFERTLLHTHDKSRTDLEQVPKIFMKPDFALDDSLTFNSVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVN
• Gene Sequence: EKIHERCKNICPPKDTFERTLLHTHDKSRTDLEQVPKIFMKPDFALDDSLTFNSVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVN
• Gene ID - Mouse: ENSMUSG00000020128
• Gene ID - Rat: ENSRNOG00000007125
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.