Description
Product Description
Protein Description: pre-B lymphocyte 1
Gene Name: VPREB1
Alternative Gene Name: CD179A, VpreB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059280: 76%, ENSRNOG00000052348: 75%
Entrez Gene ID: 7441
Uniprot ID: P12018
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: VPREB1
Alternative Gene Name: CD179A, VpreB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059280: 76%, ENSRNOG00000052348: 75%
Entrez Gene ID: 7441
Uniprot ID: P12018
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPT |
Gene Sequence | QPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPT |
Gene ID - Mouse | ENSMUSG00000059280 |
Gene ID - Rat | ENSRNOG00000052348 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti VPREB1 pAb (ATL-HPA055886) | |
Datasheet | Anti VPREB1 pAb (ATL-HPA055886) Datasheet (External Link) |
Vendor Page | Anti VPREB1 pAb (ATL-HPA055886) at Atlas Antibodies |
Documents & Links for Anti VPREB1 pAb (ATL-HPA055886) | |
Datasheet | Anti VPREB1 pAb (ATL-HPA055886) Datasheet (External Link) |
Vendor Page | Anti VPREB1 pAb (ATL-HPA055886) |