Protein Description: vasoactive intestinal peptide
Gene Name: VIP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019772: 86%, ENSRNOG00000018808: 89%
Entrez Gene ID: 7432
Uniprot ID: P01282
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: VIP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019772: 86%, ENSRNOG00000018808: 89%
Entrez Gene ID: 7432
Uniprot ID: P01282
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPE |
Gene Sequence | EGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPE |
Gene ID - Mouse | ENSMUSG00000019772 |
Gene ID - Rat | ENSRNOG00000018808 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti VIP pAb (ATL-HPA017324) | |
Datasheet | Anti VIP pAb (ATL-HPA017324) Datasheet (External Link) |
Vendor Page | Anti VIP pAb (ATL-HPA017324) at Atlas |
Documents & Links for Anti VIP pAb (ATL-HPA017324) | |
Datasheet | Anti VIP pAb (ATL-HPA017324) Datasheet (External Link) |
Vendor Page | Anti VIP pAb (ATL-HPA017324) |
Citations for Anti VIP pAb (ATL-HPA017324) – 1 Found |
Dedeene, Lieselot; Van Schoor, Evelien; Vandenberghe, Rik; Van Damme, Philip; Poesen, Koen; Thal, Dietmar Rudolf. Circadian sleep/wake-associated cells show dipeptide repeat protein aggregates in C9orf72-related ALS and FTLD cases. Acta Neuropathologica Communications. 2019;7(1):189. PubMed |