Anti VIP pAb (ATL-HPA017324)

Catalog No:
ATL-HPA017324-25
$395.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: vasoactive intestinal peptide
Gene Name: VIP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019772: 86%, ENSRNOG00000018808: 89%
Entrez Gene ID: 7432
Uniprot ID: P01282
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPE
Gene Sequence EGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPE
Gene ID - Mouse ENSMUSG00000019772
Gene ID - Rat ENSRNOG00000018808
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti VIP pAb (ATL-HPA017324)
Datasheet Anti VIP pAb (ATL-HPA017324) Datasheet (External Link)
Vendor Page Anti VIP pAb (ATL-HPA017324) at Atlas Antibodies

Documents & Links for Anti VIP pAb (ATL-HPA017324)
Datasheet Anti VIP pAb (ATL-HPA017324) Datasheet (External Link)
Vendor Page Anti VIP pAb (ATL-HPA017324)

Citations for Anti VIP pAb (ATL-HPA017324) – 1 Found
Dedeene, Lieselot; Van Schoor, Evelien; Vandenberghe, Rik; Van Damme, Philip; Poesen, Koen; Thal, Dietmar Rudolf. Circadian sleep/wake-associated cells show dipeptide repeat protein aggregates in C9orf72-related ALS and FTLD cases. Acta Neuropathologica Communications. 2019;7(1):189.  PubMed