Protein Description: vinculin
Gene Name: VCL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021823: 98%, ENSRNOG00000010765: 98%
Entrez Gene ID: 7414
Uniprot ID: P18206
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: VCL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021823: 98%, ENSRNOG00000010765: 98%
Entrez Gene ID: 7414
Uniprot ID: P18206
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRAVANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGP |
| Documents & Links for Anti VCL pAb (ATL-HPA063777 w/enhanced validation) | |
| Datasheet | Anti VCL pAb (ATL-HPA063777 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti VCL pAb (ATL-HPA063777 w/enhanced validation) at Atlas |
| Documents & Links for Anti VCL pAb (ATL-HPA063777 w/enhanced validation) | |
| Datasheet | Anti VCL pAb (ATL-HPA063777 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti VCL pAb (ATL-HPA063777 w/enhanced validation) |
| Citations for Anti VCL pAb (ATL-HPA063777 w/enhanced validation) – 2 Found |
| Rogg, Manuel; Maier, Jasmin I; Ehle, Markus; Sammarco, Alena; Schilling, Oliver; Werner, Martin; Schell, Christoph. NUP133 Controls Nuclear Pore Assembly, Transcriptome Composition, and Cytoskeleton Regulation in Podocytes. Cells. 2022;11(8) PubMed |
| Kutle, Ivana; Szymańska-de Wijs, Katarzyna M; Bogdanow, Boris; Cuvalo, Berislav; Steinbrück, Lars; Jonjić, Stipan; Wagner, Karen; Niedenthal, Rainer; Selbach, Matthias; Wiebusch, Lüder; Dezeljin, Martina; Messerle, Martin. Murine Cytomegalovirus M25 Proteins Sequester the Tumor Suppressor Protein p53 in Nuclear Accumulations. Journal Of Virology. 2020;94(20) PubMed |