Protein Description: versican
Gene Name: VCAN
Alternative Gene Name: CSPG2, PG-M
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021614: 90%, ENSRNOG00000048036: 43%
Entrez Gene ID: 1462
Uniprot ID: P13611
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: VCAN
Alternative Gene Name: CSPG2, PG-M
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021614: 90%, ENSRNOG00000048036: 43%
Entrez Gene ID: 1462
Uniprot ID: P13611
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAA |
Documents & Links for Anti VCAN pAb (ATL-HPA004726) | |
Datasheet | Anti VCAN pAb (ATL-HPA004726) Datasheet (External Link) |
Vendor Page | Anti VCAN pAb (ATL-HPA004726) at Atlas |
Documents & Links for Anti VCAN pAb (ATL-HPA004726) | |
Datasheet | Anti VCAN pAb (ATL-HPA004726) Datasheet (External Link) |
Vendor Page | Anti VCAN pAb (ATL-HPA004726) |
Citations for Anti VCAN pAb (ATL-HPA004726) – 7 Found |
Hope, Chelsea; Emmerich, Philip B; Papadas, Athanasios; Pagenkopf, Adam; Matkowskyj, Kristina A; Van De Hey, Dana R; Payne, Susan N; Clipson, Linda; Callander, Natalie S; Hematti, Peiman; Miyamoto, Shigeki; Johnson, Michael G; Deming, Dustin A; Asimakopoulos, Fotis. Versican-Derived Matrikines Regulate Batf3-Dendritic Cell Differentiation and Promote T Cell Infiltration in Colorectal Cancer. Journal Of Immunology (Baltimore, Md. : 1950). 2017;199(5):1933-1941. PubMed |
Delaine-Smith, Robin M; Maniati, Eleni; Malacrida, Beatrice; Nichols, Sam; Roozitalab, Reza; Jones, Roanne R; Lecker, Laura S M; Pearce, Oliver M T; Knight, Martin M; Balkwill, Frances R. Modelling TGFβR and Hh pathway regulation of prognostic matrisome molecules in ovarian cancer. Iscience. 2021;24(6):102674. PubMed |
Malacrida, Beatrice; Nichols, Sam; Maniati, Eleni; Jones, Roanne; Delanie-Smith, Robin; Roozitalab, Reza; Tyler, Eleanor J; Thomas, Morgan; Boot, Gina; Mackerodt, Jonas; Lockley, Michelle; Knight, Martin M; Balkwill, Frances R; Pearce, Oliver M T. A human multi-cellular model shows how platelets drive production of diseased extracellular matrix and tissue invasion. Iscience. 2021;24(6):102676. PubMed |
Murray, Elizabeth R; Menezes, Shinelle; Henry, Jack C; Williams, Josie L; Alba-Castellón, Lorena; Baskaran, Priththivika; Quétier, Ivan; Desai, Ami; Marshall, Jacqueline J T; Rosewell, Ian; Tatari, Marianthi; Rajeeve, Vinothini; Khan, Faraz; Wang, Jun; Kotantaki, Panoraia; Tyler, Eleanor J; Singh, Namrata; Reader, Claire S; Carter, Edward P; Hodivala-Dilke, Kairbaan; Grose, Richard P; Kocher, Hemant M; Gavara, Nuria; Pearce, Oliver; Cutillas, Pedro; Marshall, John F; Cameron, Angus J M. Disruption of pancreatic stellate cell myofibroblast phenotype promotes pancreatic tumor invasion. Cell Reports. 2022;38(4):110227. PubMed |
Bang-Christensen, Sara R; Pedersen, Rasmus S; Pereira, Marina A; Clausen, Thomas M; Løppke, Caroline; Sand, Nicolai T; Ahrens, Theresa D; Jørgensen, Amalie M; Lim, Yi Chieh; Goksøyr, Louise; Choudhary, Swati; Gustavsson, Tobias; Dagil, Robert; Daugaard, Mads; Sander, Adam F; Torp, Mathias H; Søgaard, Max; Theander, Thor G; Østrup, Olga; Lassen, Ulrik; Hamerlik, Petra; Salanti, Ali; Agerbæk, Mette Ø. Capture and Detection of Circulating Glioma Cells Using the Recombinant VAR2CSA Malaria Protein. Cells. 2019;8(9) PubMed |
Maniati, Eleni; Berlato, Chiara; Gopinathan, Ganga; Heath, Owen; Kotantaki, Panoraia; Lakhani, Anissa; McDermott, Jacqueline; Pegrum, Colin; Delaine-Smith, Robin M; Pearce, Oliver M T; Hirani, Priyanka; Joy, Joash D; Szabova, Ludmila; Perets, Ruth; Sansom, Owen J; Drapkin, Ronny; Bailey, Peter; Balkwill, Frances R. Mouse Ovarian Cancer Models Recapitulate the Human Tumor Microenvironment and Patient Response to Treatment. Cell Reports. 2020;30(2):525-540.e7. PubMed |
de Souza Neto, Osvaldo Rodrigues; Thais Fuzii, Hellen; Vieira Da Silva, Suély; Morais Freitas, Vanessa; Viana Pinheiro, João de Jesus. Gene Expression and Immunochemistry Analysis of ADAMTS-1 and Versican in Ameloblastoma. International Journal Of Dentistry. 2022( 36338393):5235376. PubMed |