Protein Description: vascular cell adhesion molecule 1
Gene Name: VCAM1
Alternative Gene Name: CD106
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027962: 70%, ENSRNOG00000014333: 68%
Entrez Gene ID: 7412
Uniprot ID: P19320
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: VCAM1
Alternative Gene Name: CD106
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027962: 70%, ENSRNOG00000014333: 68%
Entrez Gene ID: 7412
Uniprot ID: P19320
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPT |
| Documents & Links for Anti VCAM1 pAb (ATL-HPA069867) | |
| Datasheet | Anti VCAM1 pAb (ATL-HPA069867) Datasheet (External Link) |
| Vendor Page | Anti VCAM1 pAb (ATL-HPA069867) at Atlas |
| Documents & Links for Anti VCAM1 pAb (ATL-HPA069867) | |
| Datasheet | Anti VCAM1 pAb (ATL-HPA069867) Datasheet (External Link) |
| Vendor Page | Anti VCAM1 pAb (ATL-HPA069867) |