Description
Product Description
Protein Description: vesicle amine transport 1 like
Gene Name: VAT1L
Alternative Gene Name: KIAA1576
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046844: 100%, ENSRNOG00000011989: 100%
Entrez Gene ID: 57687
Uniprot ID: Q9HCJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: VAT1L
Alternative Gene Name: KIAA1576
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046844: 100%, ENSRNOG00000011989: 100%
Entrez Gene ID: 57687
Uniprot ID: Q9HCJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KHEAIKDSVTHLFDRNADYVQEVKRISAEGVDIVLDCLCGDNTGKGLSLLKPLGTYILYGSSNMVTGETKSFFSFAKSWWQVEKVNPIKLY |
Gene Sequence | KHEAIKDSVTHLFDRNADYVQEVKRISAEGVDIVLDCLCGDNTGKGLSLLKPLGTYILYGSSNMVTGETKSFFSFAKSWWQVEKVNPIKLY |
Gene ID - Mouse | ENSMUSG00000046844 |
Gene ID - Rat | ENSRNOG00000011989 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti VAT1L pAb (ATL-HPA061138 w/enhanced validation) | |
Datasheet | Anti VAT1L pAb (ATL-HPA061138 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti VAT1L pAb (ATL-HPA061138 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti VAT1L pAb (ATL-HPA061138 w/enhanced validation) | |
Datasheet | Anti VAT1L pAb (ATL-HPA061138 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti VAT1L pAb (ATL-HPA061138 w/enhanced validation) |