![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100551/180465/atl-hpa070267_anti-vars2-pab-atl-hpa070267_62133__50241.1681136561.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG")
Protein Description: valyl-tRNA synthetase 2, mitochondrial
Gene Name: VARS2
Alternative Gene Name: DKFZP434L1435, G7a, KIAA1885, VARS2L, VARSL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038838: 85%, ENSRNOG00000000833: 85%
Entrez Gene ID: 57176
Uniprot ID: Q5ST30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: VARS2
Alternative Gene Name: DKFZP434L1435, G7a, KIAA1885, VARS2L, VARSL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038838: 85%, ENSRNOG00000000833: 85%
Entrez Gene ID: 57176
Uniprot ID: Q5ST30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NALRFILNALGEKFVPQPAEELSPSSPMDAWILSRLALAAQECERGFLTRELSLVTHALHHFWLHNLCDVYLE |
| Documents & Links for Anti VARS2 pAb (ATL-HPA070267) | |
| Datasheet | Anti VARS2 pAb (ATL-HPA070267) Datasheet (External Link) |
| Vendor Page | Anti VARS2 pAb (ATL-HPA070267) at Atlas |
| Documents & Links for Anti VARS2 pAb (ATL-HPA070267) | |
| Datasheet | Anti VARS2 pAb (ATL-HPA070267) Datasheet (External Link) |
| Vendor Page | Anti VARS2 pAb (ATL-HPA070267) |