Protein Description: UTP6, small subunit (SSU) processome component, homolog (yeast)
Gene Name: UTP6
Alternative Gene Name: C17orf40, HCA66
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035575: 88%, ENSRNOG00000014209: 86%
Entrez Gene ID: 55813
Uniprot ID: Q9NYH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UTP6
Alternative Gene Name: C17orf40, HCA66
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035575: 88%, ENSRNOG00000014209: 86%
Entrez Gene ID: 55813
Uniprot ID: Q9NYH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGELAWIIYKNSVSIIKGAEFHVSLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAV |
Gene Sequence | ARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGELAWIIYKNSVSIIKGAEFHVSLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAV |
Gene ID - Mouse | ENSMUSG00000035575 |
Gene ID - Rat | ENSRNOG00000014209 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti UTP6 pAb (ATL-HPA025936 w/enhanced validation) | |
Datasheet | Anti UTP6 pAb (ATL-HPA025936 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti UTP6 pAb (ATL-HPA025936 w/enhanced validation) at Atlas |
Documents & Links for Anti UTP6 pAb (ATL-HPA025936 w/enhanced validation) | |
Datasheet | Anti UTP6 pAb (ATL-HPA025936 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti UTP6 pAb (ATL-HPA025936 w/enhanced validation) |