Protein Description: UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)
Gene Name: UTP3
Alternative Gene Name: CRLZ1, DKFZp761F222, FLJ23256, SAS10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070697: 91%, ENSRNOG00000003599: 88%
Entrez Gene ID: 57050
Uniprot ID: Q9NQZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UTP3
Alternative Gene Name: CRLZ1, DKFZp761F222, FLJ23256, SAS10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070697: 91%, ENSRNOG00000003599: 88%
Entrez Gene ID: 57050
Uniprot ID: Q9NQZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LNYCSNISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPK |
| Gene Sequence | LNYCSNISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPK |
| Gene ID - Mouse | ENSMUSG00000070697 |
| Gene ID - Rat | ENSRNOG00000003599 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UTP3 pAb (ATL-HPA041453) | |
| Datasheet | Anti UTP3 pAb (ATL-HPA041453) Datasheet (External Link) |
| Vendor Page | Anti UTP3 pAb (ATL-HPA041453) at Atlas |
| Documents & Links for Anti UTP3 pAb (ATL-HPA041453) | |
| Datasheet | Anti UTP3 pAb (ATL-HPA041453) Datasheet (External Link) |
| Vendor Page | Anti UTP3 pAb (ATL-HPA041453) |