Anti UTP3 pAb (ATL-HPA041453)

Catalog No:
ATL-HPA041453-100
$596.00
Protein Description: UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)
Gene Name: UTP3
Alternative Gene Name: CRLZ1, DKFZp761F222, FLJ23256, SAS10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070697: 91%, ENSRNOG00000003599: 88%
Entrez Gene ID: 57050
Uniprot ID: Q9NQZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNYCSNISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPK
Gene Sequence LNYCSNISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPK
Gene ID - Mouse ENSMUSG00000070697
Gene ID - Rat ENSRNOG00000003599
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti UTP3 pAb (ATL-HPA041453)
Datasheet Anti UTP3 pAb (ATL-HPA041453) Datasheet (External Link)
Vendor Page Anti UTP3 pAb (ATL-HPA041453) at Atlas

Documents & Links for Anti UTP3 pAb (ATL-HPA041453)
Datasheet Anti UTP3 pAb (ATL-HPA041453) Datasheet (External Link)
Vendor Page Anti UTP3 pAb (ATL-HPA041453)