Protein Description: UTP15, U3 small nucleolar ribonucleoprotein, homolog (S. cerevisiae)
Gene Name: UTP15
Alternative Gene Name: FLJ12787, FLJ23637, NET21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041747: 92%, ENSRNOG00000016591: 94%
Entrez Gene ID: 84135
Uniprot ID: Q8TED0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UTP15
Alternative Gene Name: FLJ12787, FLJ23637, NET21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041747: 92%, ENSRNOG00000016591: 94%
Entrez Gene ID: 84135
Uniprot ID: Q8TED0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LWDIPNSKEILTFKEHSDYVRCGCASKLNPDLFITGSYDHTVKMFDARTSESVLSVEHGQPVESVLLFPSGGLLVSAG |
| Gene Sequence | LWDIPNSKEILTFKEHSDYVRCGCASKLNPDLFITGSYDHTVKMFDARTSESVLSVEHGQPVESVLLFPSGGLLVSAG |
| Gene ID - Mouse | ENSMUSG00000041747 |
| Gene ID - Rat | ENSRNOG00000016591 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UTP15 pAb (ATL-HPA044697) | |
| Datasheet | Anti UTP15 pAb (ATL-HPA044697) Datasheet (External Link) |
| Vendor Page | Anti UTP15 pAb (ATL-HPA044697) at Atlas |
| Documents & Links for Anti UTP15 pAb (ATL-HPA044697) | |
| Datasheet | Anti UTP15 pAb (ATL-HPA044697) Datasheet (External Link) |
| Vendor Page | Anti UTP15 pAb (ATL-HPA044697) |