![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99169/178615/atl-hpa063665_anti-usp54-pab-atl-hpa063665_60277__13578.1681134132.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: ubiquitin specific peptidase 54
Gene Name: USP54
Alternative Gene Name: bA137L10.3, bA137L10.4, C10orf29, FLJ37318
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034235: 95%, ENSRNOG00000027012: 91%
Entrez Gene ID: 159195
Uniprot ID: Q70EL1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: USP54
Alternative Gene Name: bA137L10.3, bA137L10.4, C10orf29, FLJ37318
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034235: 95%, ENSRNOG00000027012: 91%
Entrez Gene ID: 159195
Uniprot ID: Q70EL1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EPSISSDTRTDSSTESYPYKHSHHESVVSHFSSDSQGTVIYNVENDSMSQSSRDTGHLTDSECNQKHTSKKGSLIERKRSSGRVRRKGDEPQASGYHSEGE |
| Documents & Links for Anti USP54 pAb (ATL-HPA063665) | |
| Datasheet | Anti USP54 pAb (ATL-HPA063665) Datasheet (External Link) |
| Vendor Page | Anti USP54 pAb (ATL-HPA063665) at Atlas |
| Documents & Links for Anti USP54 pAb (ATL-HPA063665) | |
| Datasheet | Anti USP54 pAb (ATL-HPA063665) Datasheet (External Link) |
| Vendor Page | Anti USP54 pAb (ATL-HPA063665) |