Description
Product Description
Protein Description: ubiquitin specific peptidase 54
Gene Name: USP54
Alternative Gene Name: bA137L10.3, bA137L10.4, C10orf29, FLJ37318
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034235: 95%, ENSRNOG00000027012: 91%
Entrez Gene ID: 159195
Uniprot ID: Q70EL1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: USP54
Alternative Gene Name: bA137L10.3, bA137L10.4, C10orf29, FLJ37318
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034235: 95%, ENSRNOG00000027012: 91%
Entrez Gene ID: 159195
Uniprot ID: Q70EL1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EPSISSDTRTDSSTESYPYKHSHHESVVSHFSSDSQGTVIYNVENDSMSQSSRDTGHLTDSECNQKHTSKKGSLIERKRSSGRVRRKGDEPQASGYHSEGE |
Gene Sequence | EPSISSDTRTDSSTESYPYKHSHHESVVSHFSSDSQGTVIYNVENDSMSQSSRDTGHLTDSECNQKHTSKKGSLIERKRSSGRVRRKGDEPQASGYHSEGE |
Gene ID - Mouse | ENSMUSG00000034235 |
Gene ID - Rat | ENSRNOG00000027012 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti USP54 pAb (ATL-HPA063665) | |
Datasheet | Anti USP54 pAb (ATL-HPA063665) Datasheet (External Link) |
Vendor Page | Anti USP54 pAb (ATL-HPA063665) at Atlas Antibodies |
Documents & Links for Anti USP54 pAb (ATL-HPA063665) | |
Datasheet | Anti USP54 pAb (ATL-HPA063665) Datasheet (External Link) |
Vendor Page | Anti USP54 pAb (ATL-HPA063665) |