Anti USP42 pAb (ATL-HPA064800)

Catalog No:
ATL-HPA064800-25
$303.00

Description

Product Description

Protein Description: ubiquitin specific peptidase 42
Gene Name: USP42
Alternative Gene Name: FLJ12697
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051306: 83%, ENSRNOG00000001059: 85%
Entrez Gene ID: 84132
Uniprot ID: Q9H9J4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TIVDKASESSDPSAYQNQPGSSEAVSPGDMDAGSASWGAVSSLNDVSNHTLSLGPVPGAVVYSSSSVPDKSKPSPQKDQALGDGIAPPQKVL
Gene Sequence TIVDKASESSDPSAYQNQPGSSEAVSPGDMDAGSASWGAVSSLNDVSNHTLSLGPVPGAVVYSSSSVPDKSKPSPQKDQALGDGIAPPQKVL
Gene ID - Mouse ENSMUSG00000051306
Gene ID - Rat ENSRNOG00000001059
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti USP42 pAb (ATL-HPA064800)
Datasheet Anti USP42 pAb (ATL-HPA064800) Datasheet (External Link)
Vendor Page Anti USP42 pAb (ATL-HPA064800) at Atlas Antibodies

Documents & Links for Anti USP42 pAb (ATL-HPA064800)
Datasheet Anti USP42 pAb (ATL-HPA064800) Datasheet (External Link)
Vendor Page Anti USP42 pAb (ATL-HPA064800)

Product Description

Protein Description: ubiquitin specific peptidase 42
Gene Name: USP42
Alternative Gene Name: FLJ12697
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051306: 83%, ENSRNOG00000001059: 85%
Entrez Gene ID: 84132
Uniprot ID: Q9H9J4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TIVDKASESSDPSAYQNQPGSSEAVSPGDMDAGSASWGAVSSLNDVSNHTLSLGPVPGAVVYSSSSVPDKSKPSPQKDQALGDGIAPPQKVL
Gene Sequence TIVDKASESSDPSAYQNQPGSSEAVSPGDMDAGSASWGAVSSLNDVSNHTLSLGPVPGAVVYSSSSVPDKSKPSPQKDQALGDGIAPPQKVL
Gene ID - Mouse ENSMUSG00000051306
Gene ID - Rat ENSRNOG00000001059
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti USP42 pAb (ATL-HPA064800)
Datasheet Anti USP42 pAb (ATL-HPA064800) Datasheet (External Link)
Vendor Page Anti USP42 pAb (ATL-HPA064800) at Atlas Antibodies

Documents & Links for Anti USP42 pAb (ATL-HPA064800)
Datasheet Anti USP42 pAb (ATL-HPA064800) Datasheet (External Link)
Vendor Page Anti USP42 pAb (ATL-HPA064800)