Protein Description: ubiquitin specific peptidase 42
Gene Name: USP42
Alternative Gene Name: FLJ12697
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051306: 83%, ENSRNOG00000001059: 85%
Entrez Gene ID: 84132
Uniprot ID: Q9H9J4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: USP42
Alternative Gene Name: FLJ12697
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051306: 83%, ENSRNOG00000001059: 85%
Entrez Gene ID: 84132
Uniprot ID: Q9H9J4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TIVDKASESSDPSAYQNQPGSSEAVSPGDMDAGSASWGAVSSLNDVSNHTLSLGPVPGAVVYSSSSVPDKSKPSPQKDQALGDGIAPPQKVL |
| Documents & Links for Anti USP42 pAb (ATL-HPA064800) | |
| Datasheet | Anti USP42 pAb (ATL-HPA064800) Datasheet (External Link) |
| Vendor Page | Anti USP42 pAb (ATL-HPA064800) at Atlas |
| Documents & Links for Anti USP42 pAb (ATL-HPA064800) | |
| Datasheet | Anti USP42 pAb (ATL-HPA064800) Datasheet (External Link) |
| Vendor Page | Anti USP42 pAb (ATL-HPA064800) |