![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101761/181926/atl-hpa077350_anti-usp39-pab-atl-hpa077350_63594__19581.1681138364.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: ubiquitin specific peptidase 39
Gene Name: USP39
Alternative Gene Name: CGI-21, SAD1, SNRNP65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056305: 100%, ENSRNOG00000010930: 100%
Entrez Gene ID: 10713
Uniprot ID: Q53GS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: USP39
Alternative Gene Name: CGI-21, SAD1, SNRNP65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056305: 100%, ENSRNOG00000010930: 100%
Entrez Gene ID: 10713
Uniprot ID: Q53GS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETN |
| Documents & Links for Anti USP39 pAb (ATL-HPA077350) | |
| Datasheet | Anti USP39 pAb (ATL-HPA077350) Datasheet (External Link) |
| Vendor Page | Anti USP39 pAb (ATL-HPA077350) at Atlas |
| Documents & Links for Anti USP39 pAb (ATL-HPA077350) | |
| Datasheet | Anti USP39 pAb (ATL-HPA077350) Datasheet (External Link) |
| Vendor Page | Anti USP39 pAb (ATL-HPA077350) |