Anti USP39 pAb (ATL-HPA077350)

Atlas Antibodies

Catalog No: ATL-HPA077350-100

• 
• 

Product Description

Protein Description: ubiquitin specific peptidase 39
Gene Name: USP39
Alternative Gene Name: CGI-21, SAD1, SNRNP65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056305: 100%, ENSRNOG00000010930: 100%
Entrez Gene ID: 10713
Uniprot ID: Q53GS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETN
• Gene Sequence: TIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETN
• Gene ID - Mouse: ENSMUSG00000056305
• Gene ID - Rat: ENSRNOG00000010930
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.