Anti USP29 pAb (ATL-HPA076515 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA076515-25

• 

Product Description

Protein Description: ubiquitin specific peptidase 29
Gene Name: USP29
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033364: 38%, ENSRNOG00000022720: 40%
Entrez Gene ID: 57663
Uniprot ID: Q9HBJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQGMAEQLQQCIEESIIDEFLQQAPPPGVRKLDAQEHTEETLNQSTELRLQKADLNHLGALGSDNPGNKNILDAENTRGEAKELTRNVKMG
• Gene Sequence: SQGMAEQLQQCIEESIIDEFLQQAPPPGVRKLDAQEHTEETLNQSTELRLQKADLNHLGALGSDNPGNKNILDAENTRGEAKELTRNVKMG
• Gene ID - Mouse: ENSMUSG00000033364
• Gene ID - Rat: ENSRNOG00000022720
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.