Protein Description: ubiquitin specific peptidase 29
Gene Name: USP29
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033364: 38%, ENSRNOG00000022720: 40%
Entrez Gene ID: 57663
Uniprot ID: Q9HBJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: USP29
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033364: 38%, ENSRNOG00000022720: 40%
Entrez Gene ID: 57663
Uniprot ID: Q9HBJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SQGMAEQLQQCIEESIIDEFLQQAPPPGVRKLDAQEHTEETLNQSTELRLQKADLNHLGALGSDNPGNKNILDAENTRGEAKELTRNVKMG |
Documents & Links for Anti USP29 pAb (ATL-HPA076515 w/enhanced validation) | |
Datasheet | Anti USP29 pAb (ATL-HPA076515 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti USP29 pAb (ATL-HPA076515 w/enhanced validation) at Atlas |
Documents & Links for Anti USP29 pAb (ATL-HPA076515 w/enhanced validation) | |
Datasheet | Anti USP29 pAb (ATL-HPA076515 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti USP29 pAb (ATL-HPA076515 w/enhanced validation) |