Anti USP24 pAb (ATL-HPA067124)

Atlas Antibodies

Catalog No: ATL-HPA067124-25

• 

Product Description

Protein Description: ubiquitin specific peptidase 24
Gene Name: USP24
Alternative Gene Name: KIAA1057
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028514: 98%, ENSRNOG00000005802: 97%
Entrez Gene ID: 23358
Uniprot ID: Q9UPU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RDSIPSEVDYETRQGVYSICLQLARFLLVGQTMPTLLDEDLTKDGIEALSSRPFRNVSRQTSRQMSLCGTPEKSSYRQLSVSDRSSIRVEEIIPAARVAIQTMEVS
• Gene Sequence: RDSIPSEVDYETRQGVYSICLQLARFLLVGQTMPTLLDEDLTKDGIEALSSRPFRNVSRQTSRQMSLCGTPEKSSYRQLSVSDRSSIRVEEIIPAARVAIQTMEVS
• Gene ID - Mouse: ENSMUSG00000028514
• Gene ID - Rat: ENSRNOG00000005802
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.