Description
Product Description
Protein Description: ubiquitin specific peptidase 24
Gene Name: USP24
Alternative Gene Name: KIAA1057
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028514: 98%, ENSRNOG00000005802: 97%
Entrez Gene ID: 23358
Uniprot ID: Q9UPU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: USP24
Alternative Gene Name: KIAA1057
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028514: 98%, ENSRNOG00000005802: 97%
Entrez Gene ID: 23358
Uniprot ID: Q9UPU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RDSIPSEVDYETRQGVYSICLQLARFLLVGQTMPTLLDEDLTKDGIEALSSRPFRNVSRQTSRQMSLCGTPEKSSYRQLSVSDRSSIRVEEIIPAARVAIQTMEVS |
Gene Sequence | RDSIPSEVDYETRQGVYSICLQLARFLLVGQTMPTLLDEDLTKDGIEALSSRPFRNVSRQTSRQMSLCGTPEKSSYRQLSVSDRSSIRVEEIIPAARVAIQTMEVS |
Gene ID - Mouse | ENSMUSG00000028514 |
Gene ID - Rat | ENSRNOG00000005802 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti USP24 pAb (ATL-HPA067124) | |
Datasheet | Anti USP24 pAb (ATL-HPA067124) Datasheet (External Link) |
Vendor Page | Anti USP24 pAb (ATL-HPA067124) at Atlas Antibodies |
Documents & Links for Anti USP24 pAb (ATL-HPA067124) | |
Datasheet | Anti USP24 pAb (ATL-HPA067124) Datasheet (External Link) |
Vendor Page | Anti USP24 pAb (ATL-HPA067124) |