Protein Description: urocanate hydratase 1
Gene Name: UROC1
Alternative Gene Name: FLJ31300, HMFN0320
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034456: 95%, ENSRNOG00000043404: 96%
Entrez Gene ID: 131669
Uniprot ID: Q96N76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UROC1
Alternative Gene Name: FLJ31300, HMFN0320
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034456: 95%, ENSRNOG00000043404: 96%
Entrez Gene ID: 131669
Uniprot ID: Q96N76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TDSPFRETSNIYDGSAFCADMAVQNFVGDACRGATWVALHNGGGVGWGEVINGGFGLVLDGTPEAEGRARLMLSWDVSNGV |
Documents & Links for Anti UROC1 pAb (ATL-HPA069863 w/enhanced validation) | |
Datasheet | Anti UROC1 pAb (ATL-HPA069863 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti UROC1 pAb (ATL-HPA069863 w/enhanced validation) at Atlas |
Documents & Links for Anti UROC1 pAb (ATL-HPA069863 w/enhanced validation) | |
Datasheet | Anti UROC1 pAb (ATL-HPA069863 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti UROC1 pAb (ATL-HPA069863 w/enhanced validation) |