Description
Product Description
Protein Description: ubiquitin related modifier 1
Gene Name: URM1
Alternative Gene Name: C9orf74, MGC2668
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069020: 93%, ENSRNOG00000026636: 94%
Entrez Gene ID: 81605
Uniprot ID: Q9BTM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: URM1
Alternative Gene Name: C9orf74, MGC2668
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069020: 93%, ENSRNOG00000026636: 94%
Entrez Gene ID: 81605
Uniprot ID: Q9BTM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHG |
Gene Sequence | SVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHG |
Gene ID - Mouse | ENSMUSG00000069020 |
Gene ID - Rat | ENSRNOG00000026636 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti URM1 pAb (ATL-HPA065160) | |
Datasheet | Anti URM1 pAb (ATL-HPA065160) Datasheet (External Link) |
Vendor Page | Anti URM1 pAb (ATL-HPA065160) at Atlas Antibodies |
Documents & Links for Anti URM1 pAb (ATL-HPA065160) | |
Datasheet | Anti URM1 pAb (ATL-HPA065160) Datasheet (External Link) |
Vendor Page | Anti URM1 pAb (ATL-HPA065160) |