Anti URM1 pAb (ATL-HPA065160)

Catalog No:
ATL-HPA065160-25
$447.00

Description

Product Description

Protein Description: ubiquitin related modifier 1
Gene Name: URM1
Alternative Gene Name: C9orf74, MGC2668
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069020: 93%, ENSRNOG00000026636: 94%
Entrez Gene ID: 81605
Uniprot ID: Q9BTM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHG
Gene Sequence SVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHG
Gene ID - Mouse ENSMUSG00000069020
Gene ID - Rat ENSRNOG00000026636
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti URM1 pAb (ATL-HPA065160)
Datasheet Anti URM1 pAb (ATL-HPA065160) Datasheet (External Link)
Vendor Page Anti URM1 pAb (ATL-HPA065160) at Atlas Antibodies

Documents & Links for Anti URM1 pAb (ATL-HPA065160)
Datasheet Anti URM1 pAb (ATL-HPA065160) Datasheet (External Link)
Vendor Page Anti URM1 pAb (ATL-HPA065160)

Product Description

Protein Description: ubiquitin related modifier 1
Gene Name: URM1
Alternative Gene Name: C9orf74, MGC2668
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069020: 93%, ENSRNOG00000026636: 94%
Entrez Gene ID: 81605
Uniprot ID: Q9BTM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHG
Gene Sequence SVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHG
Gene ID - Mouse ENSMUSG00000069020
Gene ID - Rat ENSRNOG00000026636
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti URM1 pAb (ATL-HPA065160)
Datasheet Anti URM1 pAb (ATL-HPA065160) Datasheet (External Link)
Vendor Page Anti URM1 pAb (ATL-HPA065160) at Atlas Antibodies

Documents & Links for Anti URM1 pAb (ATL-HPA065160)
Datasheet Anti URM1 pAb (ATL-HPA065160) Datasheet (External Link)
Vendor Page Anti URM1 pAb (ATL-HPA065160)