Protein Description: URI1, prefoldin-like chaperone
Gene Name: URI1
Alternative Gene Name: C19orf2, FLJ10575, NNX3, PPP1R19, RMP, URI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030421: 66%, ENSRNOG00000014463: 70%
Entrez Gene ID: 8725
Uniprot ID: O94763
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: URI1
Alternative Gene Name: C19orf2, FLJ10575, NNX3, PPP1R19, RMP, URI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030421: 66%, ENSRNOG00000014463: 70%
Entrez Gene ID: 8725
Uniprot ID: O94763
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ILEEEPQENQKKLLPLSVTPEAFSGTVIEKEFVSPSLTPPPAIAHPALPTIPERKEVLLEASEETGK |
| Documents & Links for Anti URI1 pAb (ATL-HPA071709) | |
| Datasheet | Anti URI1 pAb (ATL-HPA071709) Datasheet (External Link) |
| Vendor Page | Anti URI1 pAb (ATL-HPA071709) at Atlas |
| Documents & Links for Anti URI1 pAb (ATL-HPA071709) | |
| Datasheet | Anti URI1 pAb (ATL-HPA071709) Datasheet (External Link) |
| Vendor Page | Anti URI1 pAb (ATL-HPA071709) |