Anti UPF3A pAb (ATL-HPA061316)

Atlas Antibodies

Catalog No: ATL-HPA061316-25

• 

Product Description

Protein Description: UPF3 regulator of nonsense transcripts homolog A (yeast)
Gene Name: UPF3A
Alternative Gene Name: HUPF3A, RENT3A, UPF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038398: 88%, ENSRNOG00000017397: 88%
Entrez Gene ID: 65110
Uniprot ID: Q9H1J1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FLETYCVEEEKTSANPETLLGEMEAKTRELIARRTTPLLEYIKNRKLEKQR
• Gene Sequence: FLETYCVEEEKTSANPETLLGEMEAKTRELIARRTTPLLEYIKNRKLEKQR
• Gene ID - Mouse: ENSMUSG00000038398
• Gene ID - Rat: ENSRNOG00000017397
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.