Description
Product Description
Protein Description: UPF2 regulator of nonsense transcripts homolog (yeast)
Gene Name: UPF2
Alternative Gene Name: DKFZP434D222, KIAA1408, RENT2, smg-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043241: 100%, ENSRNOG00000023593: 92%
Entrez Gene ID: 26019
Uniprot ID: Q9HAU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UPF2
Alternative Gene Name: DKFZP434D222, KIAA1408, RENT2, smg-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043241: 100%, ENSRNOG00000023593: 92%
Entrez Gene ID: 26019
Uniprot ID: Q9HAU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGG |
Gene Sequence | LTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGG |
Gene ID - Mouse | ENSMUSG00000043241 |
Gene ID - Rat | ENSRNOG00000023593 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti UPF2 pAb (ATL-HPA067008) | |
Datasheet | Anti UPF2 pAb (ATL-HPA067008) Datasheet (External Link) |
Vendor Page | Anti UPF2 pAb (ATL-HPA067008) at Atlas Antibodies |
Documents & Links for Anti UPF2 pAb (ATL-HPA067008) | |
Datasheet | Anti UPF2 pAb (ATL-HPA067008) Datasheet (External Link) |
Vendor Page | Anti UPF2 pAb (ATL-HPA067008) |