Anti UNC79 pAb (ATL-HPA071881)

Catalog No:
ATL-HPA071881-25
$303.00

Description

Product Description

Protein Description: unc-79 homolog (C. elegans)
Gene Name: UNC79
Alternative Gene Name: KIAA1409
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021198: 80%, ENSRNOG00000008728: 79%
Entrez Gene ID: 57578
Uniprot ID: Q9P2D8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SFALPEMSLDDHPDPGTEGEKPGELMPSSGAKTVLLKVPEDAENPTESEKPDTSAESDTEQNPERKVEEDGAEESEFKIQIVPRQRKQRKIAVSA
Gene Sequence SFALPEMSLDDHPDPGTEGEKPGELMPSSGAKTVLLKVPEDAENPTESEKPDTSAESDTEQNPERKVEEDGAEESEFKIQIVPRQRKQRKIAVSA
Gene ID - Mouse ENSMUSG00000021198
Gene ID - Rat ENSRNOG00000008728
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti UNC79 pAb (ATL-HPA071881)
Datasheet Anti UNC79 pAb (ATL-HPA071881) Datasheet (External Link)
Vendor Page Anti UNC79 pAb (ATL-HPA071881) at Atlas Antibodies

Documents & Links for Anti UNC79 pAb (ATL-HPA071881)
Datasheet Anti UNC79 pAb (ATL-HPA071881) Datasheet (External Link)
Vendor Page Anti UNC79 pAb (ATL-HPA071881)

Product Description

Protein Description: unc-79 homolog (C. elegans)
Gene Name: UNC79
Alternative Gene Name: KIAA1409
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021198: 80%, ENSRNOG00000008728: 79%
Entrez Gene ID: 57578
Uniprot ID: Q9P2D8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SFALPEMSLDDHPDPGTEGEKPGELMPSSGAKTVLLKVPEDAENPTESEKPDTSAESDTEQNPERKVEEDGAEESEFKIQIVPRQRKQRKIAVSA
Gene Sequence SFALPEMSLDDHPDPGTEGEKPGELMPSSGAKTVLLKVPEDAENPTESEKPDTSAESDTEQNPERKVEEDGAEESEFKIQIVPRQRKQRKIAVSA
Gene ID - Mouse ENSMUSG00000021198
Gene ID - Rat ENSRNOG00000008728
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti UNC79 pAb (ATL-HPA071881)
Datasheet Anti UNC79 pAb (ATL-HPA071881) Datasheet (External Link)
Vendor Page Anti UNC79 pAb (ATL-HPA071881) at Atlas Antibodies

Documents & Links for Anti UNC79 pAb (ATL-HPA071881)
Datasheet Anti UNC79 pAb (ATL-HPA071881) Datasheet (External Link)
Vendor Page Anti UNC79 pAb (ATL-HPA071881)