Protein Description: unc-79 homolog (C. elegans)
Gene Name: UNC79
Alternative Gene Name: KIAA1409
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021198: 80%, ENSRNOG00000008728: 79%
Entrez Gene ID: 57578
Uniprot ID: Q9P2D8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UNC79
Alternative Gene Name: KIAA1409
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021198: 80%, ENSRNOG00000008728: 79%
Entrez Gene ID: 57578
Uniprot ID: Q9P2D8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SFALPEMSLDDHPDPGTEGEKPGELMPSSGAKTVLLKVPEDAENPTESEKPDTSAESDTEQNPERKVEEDGAEESEFKIQIVPRQRKQRKIAVSA |
Documents & Links for Anti UNC79 pAb (ATL-HPA071881) | |
Datasheet | Anti UNC79 pAb (ATL-HPA071881) Datasheet (External Link) |
Vendor Page | Anti UNC79 pAb (ATL-HPA071881) at Atlas |
Documents & Links for Anti UNC79 pAb (ATL-HPA071881) | |
Datasheet | Anti UNC79 pAb (ATL-HPA071881) Datasheet (External Link) |
Vendor Page | Anti UNC79 pAb (ATL-HPA071881) |