Protein Description: unc-13 homolog D (C. elegans)
Gene Name: UNC13D
Alternative Gene Name: Munc13-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057948: 80%, ENSRNOG00000007439: 82%
Entrez Gene ID: 201294
Uniprot ID: Q70J99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UNC13D
Alternative Gene Name: Munc13-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057948: 80%, ENSRNOG00000007439: 82%
Entrez Gene ID: 201294
Uniprot ID: Q70J99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TEWFHLKQQHHQPMVQGIPEAGKALLGLVQDVIGDLHQCQRTWDKIFHNTLKIHLFSMAFRELQWLVAKRVQDHTTVVGDVV |
Documents & Links for Anti UNC13D pAb (ATL-HPA073525) | |
Datasheet | Anti UNC13D pAb (ATL-HPA073525) Datasheet (External Link) |
Vendor Page | Anti UNC13D pAb (ATL-HPA073525) at Atlas |
Documents & Links for Anti UNC13D pAb (ATL-HPA073525) | |
Datasheet | Anti UNC13D pAb (ATL-HPA073525) Datasheet (External Link) |
Vendor Page | Anti UNC13D pAb (ATL-HPA073525) |