Protein Description: unc-13 homolog B (C. elegans)
Gene Name: UNC13B
Alternative Gene Name: hmunc13, UNC13, Unc13h2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028456: 86%, ENSRNOG00000008237: 84%
Entrez Gene ID: 10497
Uniprot ID: O14795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UNC13B
Alternative Gene Name: hmunc13, UNC13, Unc13h2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028456: 86%, ENSRNOG00000008237: 84%
Entrez Gene ID: 10497
Uniprot ID: O14795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PPDLVLQKDHFLGPQESFPEENASSPFTQARAHWIRAVTKVRLQLQEIPDD |
Documents & Links for Anti UNC13B pAb (ATL-HPA062300) | |
Datasheet | Anti UNC13B pAb (ATL-HPA062300) Datasheet (External Link) |
Vendor Page | Anti UNC13B pAb (ATL-HPA062300) at Atlas |
Documents & Links for Anti UNC13B pAb (ATL-HPA062300) | |
Datasheet | Anti UNC13B pAb (ATL-HPA062300) Datasheet (External Link) |
Vendor Page | Anti UNC13B pAb (ATL-HPA062300) |