Anti UNC119B pAb (ATL-HPA077812 w/enhanced validation)

Catalog No:
ATL-HPA077812-25
$447.00
Protein Description: unc-119 lipid binding chaperone B
Gene Name: UNC119B
Alternative Gene Name: MGC5139, POC7B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046562: 79%, ENSRNOG00000021725: 79%
Entrez Gene ID: 84747
Uniprot ID: A6NIH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence IRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGR
Gene ID - Mouse ENSMUSG00000046562
Gene ID - Rat ENSMUSG00000046562
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti UNC119B pAb (ATL-HPA077812 w/enhanced validation)
Datasheet Anti UNC119B pAb (ATL-HPA077812 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UNC119B pAb (ATL-HPA077812 w/enhanced validation) at Atlas

Documents & Links for Anti UNC119B pAb (ATL-HPA077812 w/enhanced validation)
Datasheet Anti UNC119B pAb (ATL-HPA077812 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UNC119B pAb (ATL-HPA077812 w/enhanced validation)