![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101829/182002/atl-hpa077812_anti-unc119b-pab-atl-hpa077812-wenhanced-validation_63671__73145.1681138622.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG")
Protein Description: unc-119 lipid binding chaperone B
Gene Name: UNC119B
Alternative Gene Name: MGC5139, POC7B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046562: 79%, ENSRNOG00000021725: 79%
Entrez Gene ID: 84747
Uniprot ID: A6NIH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UNC119B
Alternative Gene Name: MGC5139, POC7B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046562: 79%, ENSRNOG00000021725: 79%
Entrez Gene ID: 84747
Uniprot ID: A6NIH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGR |
| Documents & Links for Anti UNC119B pAb (ATL-HPA077812 w/enhanced validation) | |
| Datasheet | Anti UNC119B pAb (ATL-HPA077812 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti UNC119B pAb (ATL-HPA077812 w/enhanced validation) at Atlas |
| Documents & Links for Anti UNC119B pAb (ATL-HPA077812 w/enhanced validation) | |
| Datasheet | Anti UNC119B pAb (ATL-HPA077812 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti UNC119B pAb (ATL-HPA077812 w/enhanced validation) |