Anti ULBP3 pAb (ATL-HPA063007)

Atlas Antibodies

Catalog No: ATL-HPA063007-25

• 

Product Description

Protein Description: UL16 binding protein 3
Gene Name: ULBP3
Alternative Gene Name: RAET1N
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073947: 27%, ENSRNOG00000023659: 27%
Entrez Gene ID: 79465
Uniprot ID: Q9BZM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEM
• Gene Sequence: AHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEM
• Gene ID - Mouse: ENSMUSG00000073947
• Gene ID - Rat: ENSRNOG00000023659
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.