Protein Description: UL16 binding protein 1
Gene Name: ULBP1
Alternative Gene Name: RAET1I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052488: 28%, ENSRNOG00000033672: 29%
Entrez Gene ID: 80329
Uniprot ID: Q9BZM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ULBP1
Alternative Gene Name: RAET1I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052488: 28%, ENSRNOG00000033672: 29%
Entrez Gene ID: 80329
Uniprot ID: Q9BZM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | WTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPK |
| Documents & Links for Anti ULBP1 pAb (ATL-HPA071005) | |
| Datasheet | Anti ULBP1 pAb (ATL-HPA071005) Datasheet (External Link) |
| Vendor Page | Anti ULBP1 pAb (ATL-HPA071005) at Atlas |
| Documents & Links for Anti ULBP1 pAb (ATL-HPA071005) | |
| Datasheet | Anti ULBP1 pAb (ATL-HPA071005) Datasheet (External Link) |
| Vendor Page | Anti ULBP1 pAb (ATL-HPA071005) |