Protein Description: UDP glycosyltransferase 8
Gene Name: UGT8
Alternative Gene Name: CGT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032854: 96%, ENSRNOG00000009345: 96%
Entrez Gene ID: 7368
Uniprot ID: Q16880
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UGT8
Alternative Gene Name: CGT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032854: 96%, ENSRNOG00000009345: 96%
Entrez Gene ID: 7368
Uniprot ID: Q16880
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LGVSFLVLPKYERIMQKYNLLPEKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASPLPEDLQRWVNGANEHGFVLVSFGAGVKYLSEDIANKLAGA |
| Documents & Links for Anti UGT8 pAb (ATL-HPA065785) | |
| Datasheet | Anti UGT8 pAb (ATL-HPA065785) Datasheet (External Link) |
| Vendor Page | Anti UGT8 pAb (ATL-HPA065785) at Atlas |
| Documents & Links for Anti UGT8 pAb (ATL-HPA065785) | |
| Datasheet | Anti UGT8 pAb (ATL-HPA065785) Datasheet (External Link) |
| Vendor Page | Anti UGT8 pAb (ATL-HPA065785) |