Anti UGT3A2 pAb (ATL-HPA059475)

Atlas Antibodies

Catalog No: ATL-HPA059475-25

• 
• 

Product Description

Protein Description: UDP glycosyltransferase 3 family, polypeptide A2
Gene Name: UGT3A2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049152: 73%, ENSRNOG00000059568: 63%
Entrez Gene ID: 167127
Uniprot ID: Q3SY77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPLFGDQPENMVRVEAKKFGVSIQLKKLKAETLALKMKQIM
• Gene Sequence: IPLFGDQPENMVRVEAKKFGVSIQLKKLKAETLALKMKQIM
• Gene ID - Mouse: ENSMUSG00000049152
• Gene ID - Rat: ENSRNOG00000059568
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.