Protein Description: UDP-glucose pyrophosphorylase 2
Gene Name: UGP2
Alternative Gene Name: UGP1, UGPP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001891: 98%, ENSRNOG00000008079: 99%
Entrez Gene ID: 7360
Uniprot ID: Q16851
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UGP2
Alternative Gene Name: UGP1, UGPP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001891: 98%, ENSRNOG00000008079: 99%
Entrez Gene ID: 7360
Uniprot ID: Q16851
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | IFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKRE |
Documents & Links for Anti UGP2 pAb (ATL-HPA064836 w/enhanced validation) | |
Datasheet | Anti UGP2 pAb (ATL-HPA064836 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti UGP2 pAb (ATL-HPA064836 w/enhanced validation) at Atlas |
Documents & Links for Anti UGP2 pAb (ATL-HPA064836 w/enhanced validation) | |
Datasheet | Anti UGP2 pAb (ATL-HPA064836 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti UGP2 pAb (ATL-HPA064836 w/enhanced validation) |