Description
Product Description
Protein Description: ubiquitin-fold modifier conjugating enzyme 1
Gene Name: UFC1
Alternative Gene Name: HSPC155
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062963: 98%, ENSRNOG00000003706: 99%
Entrez Gene ID: 51506
Uniprot ID: Q9Y3C8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UFC1
Alternative Gene Name: HSPC155
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062963: 98%, ENSRNOG00000003706: 99%
Entrez Gene ID: 51506
Uniprot ID: Q9Y3C8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ |
Gene Sequence | IPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ |
Gene ID - Mouse | ENSMUSG00000062963 |
Gene ID - Rat | ENSRNOG00000003706 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti UFC1 pAb (ATL-HPA027481 w/enhanced validation) | |
Datasheet | Anti UFC1 pAb (ATL-HPA027481 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti UFC1 pAb (ATL-HPA027481 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti UFC1 pAb (ATL-HPA027481 w/enhanced validation) | |
Datasheet | Anti UFC1 pAb (ATL-HPA027481 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti UFC1 pAb (ATL-HPA027481 w/enhanced validation) |