Protein Description: UBX domain protein 8
Gene Name: UBXN8
Alternative Gene Name: D8S2298E, REP8, UBXD6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052906: 76%, ENSRNOG00000015109: 79%
Entrez Gene ID: 7993
Uniprot ID: O00124
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UBXN8
Alternative Gene Name: D8S2298E, REP8, UBXD6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052906: 76%, ENSRNOG00000015109: 79%
Entrez Gene ID: 7993
Uniprot ID: O00124
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KSPQVYLKEEEEKNEKRQKLVRKKQQEAQGEKASRYIENVLKPHQEMKLRKLEERFYQMTGEAWKLSSGHK |
Documents & Links for Anti UBXN8 pAb (ATL-HPA077538) | |
Datasheet | Anti UBXN8 pAb (ATL-HPA077538) Datasheet (External Link) |
Vendor Page | Anti UBXN8 pAb (ATL-HPA077538) at Atlas |
Documents & Links for Anti UBXN8 pAb (ATL-HPA077538) | |
Datasheet | Anti UBXN8 pAb (ATL-HPA077538) Datasheet (External Link) |
Vendor Page | Anti UBXN8 pAb (ATL-HPA077538) |