Anti UBXN6 pAb (ATL-HPA061872)

Atlas Antibodies

Catalog No: ATL-HPA061872-25

• 
• 

Product Description

Protein Description: UBX domain protein 6
Gene Name: UBXN6
Alternative Gene Name: UBXD1, UBXDC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019578: 79%, ENSRNOG00000048509: 79%
Entrez Gene ID: 80700
Uniprot ID: Q9BZV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KFFQEFKADIKFKSAGPGQKLKESVGEKAHKEKPNQPAPRPPRQGPTNEAQMAAAAALARLEQKQSRA
• Gene Sequence: KFFQEFKADIKFKSAGPGQKLKESVGEKAHKEKPNQPAPRPPRQGPTNEAQMAAAAALARLEQKQSRA
• Gene ID - Mouse: ENSMUSG00000019578
• Gene ID - Rat: ENSRNOG00000048509
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.