Protein Description: UBX domain protein 2A
Gene Name: UBXN2A
Alternative Gene Name: UBXD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020634: 98%, ENSRNOG00000004950: 96%
Entrez Gene ID: 165324
Uniprot ID: P68543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UBXN2A
Alternative Gene Name: UBXD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020634: 98%, ENSRNOG00000004950: 96%
Entrez Gene ID: 165324
Uniprot ID: P68543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NGFTVNDDFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVEDKK |
| Documents & Links for Anti UBXN2A pAb (ATL-HPA069096) | |
| Datasheet | Anti UBXN2A pAb (ATL-HPA069096) Datasheet (External Link) |
| Vendor Page | Anti UBXN2A pAb (ATL-HPA069096) at Atlas |
| Documents & Links for Anti UBXN2A pAb (ATL-HPA069096) | |
| Datasheet | Anti UBXN2A pAb (ATL-HPA069096) Datasheet (External Link) |
| Vendor Page | Anti UBXN2A pAb (ATL-HPA069096) |