Anti UBXN2A pAb (ATL-HPA065482)

Catalog No:
ATL-HPA065482-25
$447.00

Description

Product Description

Protein Description: UBX domain protein 2A
Gene Name: UBXN2A
Alternative Gene Name: UBXD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020634: 75%, ENSRNOG00000004950: 77%
Entrez Gene ID: 165324
Uniprot ID: P68543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MKDVDNLKSIKEEWVCETGSDNQPLGNNQQSNCEYFVDSLFEEAQKVSSKCVSPAEQKKQVDVN
Gene Sequence MKDVDNLKSIKEEWVCETGSDNQPLGNNQQSNCEYFVDSLFEEAQKVSSKCVSPAEQKKQVDVN
Gene ID - Mouse ENSMUSG00000020634
Gene ID - Rat ENSRNOG00000004950
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti UBXN2A pAb (ATL-HPA065482)
Datasheet Anti UBXN2A pAb (ATL-HPA065482) Datasheet (External Link)
Vendor Page Anti UBXN2A pAb (ATL-HPA065482) at Atlas Antibodies

Documents & Links for Anti UBXN2A pAb (ATL-HPA065482)
Datasheet Anti UBXN2A pAb (ATL-HPA065482) Datasheet (External Link)
Vendor Page Anti UBXN2A pAb (ATL-HPA065482)

Product Description

Protein Description: UBX domain protein 2A
Gene Name: UBXN2A
Alternative Gene Name: UBXD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020634: 75%, ENSRNOG00000004950: 77%
Entrez Gene ID: 165324
Uniprot ID: P68543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MKDVDNLKSIKEEWVCETGSDNQPLGNNQQSNCEYFVDSLFEEAQKVSSKCVSPAEQKKQVDVN
Gene Sequence MKDVDNLKSIKEEWVCETGSDNQPLGNNQQSNCEYFVDSLFEEAQKVSSKCVSPAEQKKQVDVN
Gene ID - Mouse ENSMUSG00000020634
Gene ID - Rat ENSRNOG00000004950
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti UBXN2A pAb (ATL-HPA065482)
Datasheet Anti UBXN2A pAb (ATL-HPA065482) Datasheet (External Link)
Vendor Page Anti UBXN2A pAb (ATL-HPA065482) at Atlas Antibodies

Documents & Links for Anti UBXN2A pAb (ATL-HPA065482)
Datasheet Anti UBXN2A pAb (ATL-HPA065482) Datasheet (External Link)
Vendor Page Anti UBXN2A pAb (ATL-HPA065482)